SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015474 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015474
Domain Number 1 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 210-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.41e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 267-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 9-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 119-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000207
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015474   Gene: ENSTTRG00000016326   Transcript: ENSTTRT00000016326
Sequence length 422
Comment pep:novel genescaffold:turTru1:GeneScaffold_371:46532:50931:-1 gene:ENSTTRG00000016326 transcript:ENSTTRT00000016326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRNLPQGSVTFEDVAVYFSWEEWDLLDDAQRCLYHNVMLENLALITSLEIQHQKQ
NIGEKCFRSNMDRASFMKDCKFFVSGKSLSHGESTYTREKSNRGTECGAAFHRGKTHYNS
GECTEDFSCKHMLFQHQRVPTREKCYMCSECGKSFSKSYSLNDHWRVHTGEKPYECGECG
KTFRQSSSLIQHRRVHTGVRPHECDECGKSFSNKSNLIKHRRIHTGERPYECSECGKSFS
ESSALLQHRSVHTGERPYECSECGKFFTYHSSLIKHQRVHSGSRPYECSECGKSFTQNSS
LIEHHRVHSGERPYKCSECGKSFSQSSALLQHRRVHTGERPYECSECGKFFTYSSSLLKH
QRVHTGSRPYECSECGKSFTQNSSLIKHRRIHTGEKPYECSECGKSFSHSSSLIKHRRVH
TG
Download sequence
Identical sequences ENSTTRP00000015474 ENSTTRP00000015474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]