SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015684 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015684
Domain Number 1 Region: 436-546,659-809
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.68e-55
Family Phosphate binding protein-like 0.00000938
Further Details:      
 
Domain Number 2 Region: 18-423
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.65e-33
Family L-arabinose binding protein-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015684   Gene: ENSTTRG00000016543   Transcript: ENSTTRT00000016543
Sequence length 1007
Comment pep:novel genescaffold:turTru1:GeneScaffold_3036:13502:689880:-1 gene:ENSTTRG00000016543 transcript:ENSTTRT00000016543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNVSHVFTSLFTTMKTEELNRYRDTLRRAILLLSPLGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDSQKCMRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKDHITGLTGVMEFREDSSPYVQFEILGTXXXXXXXXDMRKLATWDSEKVN
GSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKY
EIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVG
ILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVMIFVLNRIQAVRAQSAAQPRPSAS
ATLNSAIWIVYGAFVQQGGESSANSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMD
NPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCV
SSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVTGNSVSSKGYGIALQHGSPYRD
LFSQRILELQDTGDLDVLKQKWWPHTGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGL
LLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSA
LEMGGLAPSQALEPAREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSSLPLPLSSSATMP
SMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences ENSTTRP00000015684 ENSTTRP00000015684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]