SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016166 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016166
Domain Number 1 Region: 30-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.97e-21
Family Ubiquitin-related 0.0000108
Further Details:      
 
Domain Number 2 Region: 427-498
Classification Level Classification E-value
Superfamily UBA-like 4.57e-18
Family UBA domain 0.00015
Further Details:      
 
Domain Number 3 Region: 312-380
Classification Level Classification E-value
Superfamily UBA-like 0.000000000195
Family UBA domain 0.019
Further Details:      
 
Domain Number 4 Region: 197-349
Classification Level Classification E-value
Superfamily TPR-like 0.000000035
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 5 Region: 395-433
Classification Level Classification E-value
Superfamily UBA-like 0.00000209
Family UBA domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016166   Gene: ENSTTRG00000017052   Transcript: ENSTTRT00000017052
Sequence length 576
Comment pep:novel genescaffold:turTru1:GeneScaffold_59:65055:87096:1 gene:ENSTTRG00000017052 transcript:ENSTTRT00000017052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLAKKYSDKLECCENEVEKIIEEIRCKAVERGTGNEHYKATGIATIEVFLPPRVKKDRKN
LLETRLHVTGRELRSKIAETFGFQENYIKIVINKKQLQLGKTLEEQGVTHNVKAMVLELK
QSEEDVRKNSQVEEEEQNEARLKEKRIQRTKRGLEILAERXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXALMLAMGYHEKGRAFLKRKEYGIALPCLLDADRYFCECCRELLDTVDN
YAVLQLDIAWCYFRLGQLECLDDAEKKLNMAQRCFKNCYGENHQRLVHIKGNCGKEKVLF
LRLYLLQGIRNYHSGNGEEAYDYLNKACQLFKELYIDPSKVHSLMQLGFSAQEARLGLRA
CDGNVDHAAAHITNRREKLDQIRKEEKEKKRRRLENINYLKGMGYSARAAKQALHQASGN
LEESLQILLSQPQMWWLNDSGPETNSHQESPSRGTIDQLVYMGFDAAAAEAALRVFRGNV
QLAAQTLAHNGGSLPSGLRLSAEDSSATPPTSPSDSAGTSSASTDEDMETEAVNEILEDI
PEHEEDYLDSTLEDEEIIIAEYLSYVESIKTATKRN
Download sequence
Identical sequences ENSTTRP00000016166 ENSTTRP00000016166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]