SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016348 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016348
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.05e-19
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016348   Gene: ENSTTRG00000017246   Transcript: ENSTTRT00000017246
Sequence length 133
Comment pep:novel genescaffold:turTru1:GeneScaffold_1825:41261:42355:-1 gene:ENSTTRG00000017246 transcript:ENSTTRT00000017246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLFVRAQELHTLEVTVQETVAQIKAHVASLEGIAPEDQVLLMAGTPLEDEATLGQCGVE
ALSTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVV
PTFGKKKGPNANS
Download sequence
Identical sequences ENSTTRP00000016348 XP_004264390.1.21590 XP_004324529.1.83887 ENSTTRP00000016348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]