SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016524 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016524
Domain Number 1 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 13-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-20
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 198-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-19
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 5 Region: 352-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-17
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000134
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016524   Gene: ENSTTRG00000021453   Transcript: ENSTTRT00000021445
Sequence length 421
Comment pep:novel genescaffold:turTru1:GeneScaffold_1069:59387:66804:1 gene:ENSTTRG00000021453 transcript:ENSTTRT00000021445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEAQAQLNSSLQAPVTFEDVAVYFSREEWGILNLTQRSLYRDVMLENFALIGSLGFAP
LRSLAVAQMKCEEEPWMPNMVDMTVVSRAEARMGPGLGFLCRLQDEEAPPEQVKSHRVLQ
PQATHREGTPRRSTERKAFPPSSTRQQRQGAHATQKPFKCSNCGQAFLKAFTLLDHLITH
TKERPFRCPAGGNAPMESSTLVHHRKTHTGETSHVCNECGKAFSYPSKLRKHQKVHTGIK
PFKCGECGKTFNRKDALVLHQRIHTGERPYQCSECGKSFSVLSTLIRHRKVHIGERPYEC
RECGKFFKYNHSFILHQRVHTGERPYECSECGKTYVTRSGLYQHWKVHTGERPYECSLCG
KTFTTRSYRNRHQQFHTEERAYECTECGKAFKHSSTLLQHKKVHTGERPGDGCGKTFRHG
W
Download sequence
Identical sequences ENSTTRP00000016524 ENSTTRP00000016524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]