SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016533 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016533
Domain Number 1 Region: 292-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 464-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 5 Region: 337-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000153
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000277
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 200-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000295
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016533   Gene: ENSTTRG00000021412   Transcript: ENSTTRT00000021410
Sequence length 580
Comment pep:novel genescaffold:turTru1:GeneScaffold_3341:22787:25365:-1 gene:ENSTTRG00000021412 transcript:ENSTTRT00000021410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLTLEDVAVEFNWEEWQLLDAAQKDLYRDVMLENFNNLVSLGYQATKPESLSKMEHGKE
PCIIENKIQNRTRPGIRKVDSHLPEHSQGQRFPKSLQQCSEQNAFRKSVHLSKTHLALTQ
NHTFDLCKKAWKSSLCLVNQKRRYEIKNPVEFNGDKKFFLHGDREQLYSGIEFPESIKHI
IAKFQVFKRQRTHKIEKSQACVGSEKTCIRKSQLISQESIHIGDKLHQCDLCEKSFSRNV
MFTKHQKPQTRDKPHLTSGCRKVSTVKSSPTVHQQTQTGEKSYMCSECGKGFTVRRYLIA
HQRTHSGEKPYVCSECGKGFTVKSNLIVHQRTHTREKPYVCSECAKGFTMKRYLVVHQRT
HTGEKPYLCSECGKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXICLIQHERCHTVKTPFV
CTECGKSYSHKYGLITHQRIHTGEKPYECNECGKAFTTKSVLNVHQRTHTGERPYGCSDC
EKAFSHLSNLVKHKKMHIREMSRGQVGNSFNRESQLITYD
Download sequence
Identical sequences ENSTTRP00000016533 ENSTTRP00000016533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]