SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000204 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000204
Domain Number 1 Region: 1270-1432,1460-1539
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-41
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 742-968
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 81-236,333-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-35
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1605-1853
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.26e-32
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000204
Domain Number - Region: 1541-1582
Classification Level Classification E-value
Superfamily PRTase-like 0.0801
Family Phosphoribosyltransferases (PRTases) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000204   Gene: ENSTTRG00000000218   Transcript: ENSTTRT00000000219
Sequence length 2374
Comment pep:novel genescaffold:turTru1:GeneScaffold_66:217632:280092:1 gene:ENSTTRG00000000218 transcript:ENSTTRT00000000219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEDGAGAEESGQPRGFMQLNDLSGAVGRPGPGSAEKDPGSVDSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLERYYQTENEDENPFICSQPRENGMRSCRSVPTLRGDGGGGPPCVL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPR
MLKEEALMEVAPTSGPPTLTSLNIPPRSYSSMHKLLETQSTGACQSSCKISSPCLKADSG
ACGPDSCPYCVRTGAGEVELAGHEMPDSDSEAVYEFTQDAQHGDRQNPHSWRRRSLGLDV
EPNSVLAFWRLVCDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDATKSESEPDFFSPSLDGDGDRKKRL
ALVSLGEHPELRRSLLPPLIIHTAATPMSLPKSSSTGLAEVVGPASRRASSSGSAEPGAP
HETKSPPSARSSPHSPWSAASRWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGDGQESQ
DEHESSEEERASPAGSDRRRRGSLEREAKSSFDLPDTLVPGLHRTASDRSSASEHQDCNG
KSAPRLTRALRTDDPPLWDDDDKALSKGERMRAWVRARLPACCLERDSWSAYIFPPQSRF
RLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFLAEM
TVKVVALGWCFGEQAYLRSSWNVLDGLLVLISIIDILVSMVSDSGTKILGMLRVLRLLRT
LRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGED
TRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQP
IMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLRRLEK
KRRNLMLDDVIASGSSASAAPEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNV
VTMAMEHYQQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLL
SIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGN
LGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWN
GIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEA
ELEAELELEMKPLSPQAPSPPGSPFLWPGAEGPDSPGSPKPGAPQAAAHAEAVSHFSLEH
PMDRQLFDTISLLIQGSLEGELKLMEELAGPGGPPSAFPPTRSLGGSNPQIPLAETEALS
LTSEIVSELSCSVALTDDSLPDDTHTLLLSALESNMESHTEEVPVMLRPDLLTVRKSGVS
RTHSLPNDSYMCRDGSTAEGSLGHRGWGLPKAQSGSVLSVHSQPADTSYILQLPKDAPHL
LQPHGAPTWGTIPKLPPPARSPLAQRPLRRQAAIRTDSLDVQGLDSREDLLSEVSGPSPP
LAGASSFWGRSSAQAQQHSHGQSKISKHMPPSAPCPGPEPTWSKGPSEIRSSLELDTLSW
IGDLLPVGSQEEAPSPRDKKCYSVEARSCPRRPASWLDAQRRHSIAVSCLDSGSQPRLGP
GSSSLRGQPLGGPGSRPKKKLSPPSISIEPPESQSQGPRPPPSPGVCLRRRAPSSDSKEP
SASGPPDSMAASPPPKKDVLSLSGLSSDPADLDP
Download sequence
Identical sequences ENSTTRP00000000204 ENSTTRP00000000204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]