SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000364 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000364
Domain Number 1 Region: 1286-1448,1476-1555
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.22e-39
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 786-1013
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 98-254,355-422
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 1638-1812
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-25
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000364   Gene: ENSTTRG00000000388   Transcript: ENSTTRT00000000390
Sequence length 2337
Comment pep:novel genescaffold:turTru1:GeneScaffold_3289:8461:73089:1 gene:ENSTTRG00000000388 transcript:ENSTTRT00000000390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESVQAADEVRVPLGAPAPGPAAGASPASPGAPGPEAERGSRPGASPPQSPAAERGAEL
GADEEQPVPYPALAATVFFCLGQTTRPRSWCLRLVCNPWFEHVSMLVIMLNCVTLGMFRP
CEDVECRSERCSILEAFDDFIFAFFAVEMVIKMIALGLFGQKCYLGDTWNRLDFFIVMAG
XXXSYSLDGHNVSLSAIRTVLVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVF
FIFGIVGVQLWAGLLRNRCFLDSTFARNSNLSFLRPYYQPEEGEENPFICSSRRDNGMQK
CSHIPSRRELRVECTLGWEAYGQPQAEGAGARHTCINWNQYYNVCRSGDSNPHNGAISFD
NIGYAWIAIFQVITLEGWVDIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQF
SETKQRESQLMREQRARYLSNDSTLASFSEPGSCYEELLRYVGHVCRKLKRRGLRLYARW
QSRWRKKVDPSGAPHSQGAGRRPRRAGGRATSIHHLVYHHHHHHHHHYHFSHDSSRRPGL
EPGGSDTRLVRAGAPPSPGHGPPDAESVHSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXGPGSKGKGHGGPLGHGGHGPMRLSIPDSCEKIQHVV
GEHGLGQAPSRLSGLSVPCPLPSPQAGTLTCELSSCPYCTSALEDPELEFNDSDSGDSDS
NGVYEFTRDVRHGDRRDPMQPPPAADTPDSGGTRRRAQRRAVAGEQGGLGRVWASFSGKL
CRIVDSKYFNRGIMVAILTNTLSMGIEYHEQPDELTNALEISNIVFTSMFALEMLLKLLA
FGPLGYIRNPYNIFDGIIVVISVWEIIGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLV
VLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFSLKTDTGDTVPDRKNFDSLLWAIVT
VFQILTQEDWNVVLYNGMASTSSWAALYFVALMTFGNYVLFNLLVAILVEGFQAEGDATR
SDTDEDKTSTHLEEDLDKFRDLRATEMKMYSLAVTPNGHLEGQASLPPPLIMRTAATPMP
TPKSSPHLDAAPGLLDSRRGSSSSVDPQLGDQKSLSSLRSSPCTHWGPNSACSSRRSSWN
SLGRAPSLKRSQCGERESLLSGEGKGSGSTDEEAEDSRTSPDTRATLLRRTESLDLRPLR
PAALLPTKLHDCNGLALPSELFLRIDSHKEDTAEFDDDVEDSCCSRLQKVLEPYKPECCR
SREPWALYLFSPQNRLRISCQKIIAHKMFDHVVLVFIFLNCITIALERPDIDPGSTERVF
LSISNYIFTAIFVAEMMVKVVALGLVSGEHAYLQSSWNILDGLLVLVSLVDIIVAMASAG
GAKILGILRVLRLLRTLRPLRVISRAPGLKLVVETLISSLRPIGNIVLICCAFFIIFGIL
GVQLFKGKFYYCEGADTRNISTKAECWAAHYRWVRRKYNFDNLGQALMSLFVLSSKDGWV
NIMYDGLDAVGIDQQPVPNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEA
EEARRREEKRQRRLERKRRSTFPNPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSLDEALKYCNYVFTIVFVFEALLKLVAFGFRRFFKDRWNQLDLA
IVLLSIMGITLEEIEMNAALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALP
QVGNLGLLFMLLFFIYAALGVELFGRLECSEDNPCEGLSRHATFSNFGMAFLTLFRVSTG
DNWNGIMKDTLRECAREDRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVTAHLPPVESCPSLQVPSAMSSP
ARGGDTLRALTPLGAARSPSLSWLLCTQEVVCTESLEGQVDGPRDSSPGWGEPGGKTPVR
QAPLGPSLRSPPSSPRPTSIRIRKHTSGQNYISSRPPVLGAEEAEAPDPADEEVSHITSS
AHPLGLAACGVVGGEPDLHRLYSVNAQGFLDQPGWADEQRRPSVEQGCGDSCPEAGEVKT
RALEAELALGARRKKKMSPPCISIEPPAEDEGAARAPAAEGGSTTLRRRTPSCEAVPHRD
PLEPTDSAGLDTAAKGERRVQVPCRTEHLTIPNFAFEPLDVGGPRGDLFLDGGHGVAPEP
RPSSSGITAPPEPQQTEPPVASGDPPEEGWGLHLTVPESPLKKGSTPVLGDSVDKPV
Download sequence
Identical sequences ENSTTRP00000000364 ENSTTRP00000000364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]