SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000399 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000399
Domain Number 1 Region: 23-48,97-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-24
Family Voltage-gated potassium channels 0.0021
Further Details:      
 
Domain Number 2 Region: 162-260
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-18
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000399   Gene: ENSTTRG00000000426   Transcript: ENSTTRT00000000426
Sequence length 339
Comment pep:novel genescaffold:turTru1:GeneScaffold_821:226879:238835:-1 gene:ENSTTRG00000000426 transcript:ENSTTRT00000000426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECRRRAREAPEGRVWGCAMPSTWLLLLAYLTYLALGTGVFWLLESPAAHDSSERFQRDKW
ALLRNFTCLDGPALDSLIRGVIQAYQNGDIVLDNTTSMGRWEFVGSFFFSVSTITTIGYG
NLSPRTMGARLFCIFFALVGIPLNLVVLNRLGHLMQQGVHSCARMLGVTWKDPAKARWLV
GSSALLSGLLLFLLLPPLLFSHVEGWSYVEGFYFSFITLSTVGFGDYVIEMNPSRNYPLW
YKNTVSLWILFGMAWLALINSSPCWRLHEDRIPATATALRGTSSPEAGARAWMERQSPTP
RSQAALWRDLSIAQNPLFKSHTVERTASYIPLFHLLLQQ
Download sequence
Identical sequences ENSTTRP00000000399 ENSTTRP00000000399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]