SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000400 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000400
Domain Number 1 Region: 13-40,89-163
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-24
Family Voltage-gated potassium channels 0.0041
Further Details:      
 
Domain Number 2 Region: 150-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-18
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000400   Gene: ENSTTRG00000000427   Transcript: ENSTTRT00000000427
Sequence length 305
Comment pep:novel genescaffold:turTru1:GeneScaffold_821:239505:247152:-1 gene:ENSTTRG00000000427 transcript:ENSTTRT00000000427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTRLCSCWGGQVLPLLLAYVCYLLLGATIFQLLEKQAEAQSRDQFQFEKLRFLENYTC
LDQQAVEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALVGIPLNVLFLNHLGTGLHAHLTTLERWEDQPRRSQLLQTLGLALFLALGT
LLVLIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALVLPLGPLLLHRCSQLWLLRLRQGCEAEEADETPREGPTAARRVTPDFLRQR
RGLRN
Download sequence
Identical sequences ENSTTRP00000000400 ENSTTRP00000000400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]