SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000491 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000491
Domain Number 1 Region: 471-552
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000726
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000491   Gene: ENSTTRG00000000523   Transcript: ENSTTRT00000000524
Sequence length 597
Comment pep:novel genescaffold:turTru1:GeneScaffold_2512:241630:262438:1 gene:ENSTTRG00000000523 transcript:ENSTTRT00000000524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTMKPPKGFAPMSCCWSTATMQKRLPFLAWLPDYTWHALKMDFIAGISVGLTVIPQAL
AYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDVTLGPTAIMSLLVSFYTFREPAYAVLLA
FLSGCIQLGMGFLRLGFLLDFISCPVIKGFTSAAAIIIGFGQIKNLLGLQHISRQFFLQV
YYTFRNIGETRVGDAVLGLVCMVLLLVLKLMRDHVPPVHPEMPTGVRLSHGLVWTATTXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
AGLAVVPMMGLLESIAVAKSFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
AVNAQSGVCTPAGGLMTGALVLLSLDYLTSLFYYIPKSALAAVIIMAVVPLFDTKIVGTL
WRVKRLDLLPLCVTFLLCFWEVQYGILTGTLVSMLVLLHSVARPKIQVSEGPMLVLQPAS
GLHFPAIETLREALLSRALETSPPRSAALDCTHICSIDYTVVLGLGELLEDFHKRGATLA
LIGLVPVLRVLLSADLKGVLYFCTLEEAEKYLKQEPGTPPYNGSEDSVPEHKIALLK
Download sequence
Identical sequences ENSTTRP00000000491 ENSTTRP00000000491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]