SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000503 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000503
Domain Number 1 Region: 649-844
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000428
Further Details:      
 
Domain Number 2 Region: 466-578
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-20
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 11-92
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000856
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 259-298
Classification Level Classification E-value
Superfamily WW domain 0.00000000994
Family WW domain 0.0022
Further Details:      
 
Domain Number 5 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000208
Family WW domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000503   Gene: ENSTTRG00000000538   Transcript: ENSTTRT00000000537
Sequence length 846
Comment pep:novel genescaffold:turTru1:GeneScaffold_2428:10120:102504:-1 gene:ENSTTRG00000000538 transcript:ENSTTRT00000000537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMADRGGKIVPGQVYIEVEYDYEYEAKDRKVVIKQGERYILVKKTNDDWWQVKLDENSK
AFYVPAQYVREVGRRALMPPVKQAAGLPNHSVKTMQSLHLQRSTENVSKLPELSSFGKPS
PSVQGTGLTRDANQNFGPSYIPGQTVNLSLDLTHNNGKFNSDSHSPKVSGQNRTRLFGHF
PGPEFLDVEKAGFSQEQSCDSAGEGSERIHHDSESGDELSSSSTEQIRATTPPHQGRPDS
PVYANLQELKISQSALPPIPGSPAIQINGEWETHKDSSGRCYYYNRGTQERTWKPPRWTR
DTNISKGDSQSPGDQELLSSEENYHSVCYSQSDSQCGSPPRGWSEELDARGHTLYTSDCT
NEKWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDANDKESPTASKPCYPENESSPSSPKNQDTASSPKGQEKYGLLNVTKITENGK
KVRKNWLSSWAVLQGSSLLFTKTQGSSTSWFGSNQSKPEFTVDLKGATIEMASKDKSSKK
NVFELKTRQGTELLIQSDNDAVINEWFKVLSSTISNQTVEPDEAIEEDVPDSPGIEKHDK
EKDHKDLKKSRSTKVSSIDSSEQKKTKKNLKKFLTRRPTLQAVREKGYIKDQVFGANLAN
LCQRENGTVPKFVKLCIEHVEQYGLDVDGIYRVSGNLAVIQKLRFTVNHDEKLDLKDSKW
EDIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVSAVKDLIKQLPKPNQDTM
QTLFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLEV
NSIFGR
Download sequence
Identical sequences ENSTTRP00000000503 ENSTTRP00000000503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]