SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000810 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000810
Domain Number 1 Region: 55-192
Classification Level Classification E-value
Superfamily PH domain-like 0.0000083
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000810   Gene: ENSTTRG00000000859   Transcript: ENSTTRT00000000858
Sequence length 199
Comment pep:novel genescaffold:turTru1:GeneScaffold_1966:243231:250715:-1 gene:ENSTTRG00000000859 transcript:ENSTTRT00000000858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKKKRHSSSSSQSSEFSTRSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNSNSDTCA
EFRIKYVGAIEKLKLSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIKV
STSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYNLWVYQCHSLEQAQ
AICKVLSTAFDSVLTSEKP
Download sequence
Identical sequences ENSTTRP00000000810 ENSTTRP00000000810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]