SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000905 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000905
Domain Number 1 Region: 338-467
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-27
Family Ran-binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000905   Gene: ENSTTRG00000000961   Transcript: ENSTTRT00000000961
Sequence length 469
Comment pep:novel genescaffold:turTru1:GeneScaffold_452:33721:46677:1 gene:ENSTTRG00000000961 transcript:ENSTTRT00000000961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDGGGAFKD
FKGLVIPSGGGGFSGFGNGAEGKPLEGLSNGNSITSAPPFSSARTATETKATFGSVAVNG
PTSLVDKKISNPKTNGDSQQPASSGLTSSAARHRNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSNSEGETNKVSVETQPPSLFGSTELQQESTFLF
HGNKTEDTSEKKVEAVSEKNKDPSLGATSASFNFGKKIDSSVLGSLNSGPLTGFSFSSGN
SSLFGKDITQSKPVXXXXXXXXXXSRAEGGGSDCKGGDEEESDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRT
GKNNVLIVCVPNPPIDEKNATTPVTMLIRVKTSEDADELHRILQEKKDA
Download sequence
Identical sequences ENSTTRP00000000905 ENSTTRP00000000905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]