SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000979 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000979
Domain Number 1 Region: 556-664
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-25
Family Phosphotyrosine-binding domain (PTB) 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000979
Domain Number - Region: 450-494
Classification Level Classification E-value
Superfamily SH3-domain 0.00019
Family SH3-domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000979   Gene: ENSTTRG00000001041   Transcript: ENSTTRT00000001041
Sequence length 672
Comment pep:novel genescaffold:turTru1:GeneScaffold_3496:115591:124379:1 gene:ENSTTRG00000001041 transcript:ENSTTRT00000001041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSGGSGGGGSRLQAEMLQM
DLIDAAGDTPGAEDDEEEDEEERAARRPVAGPPEAEPHQETAPRGQGQGQGPGGGDTYRP
KRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELP
PPSSPAPTKDRGTSTDSPCRRSAATQMAPPGGPPAAPPAGRGHSHRDRIHYQADVRLEAT
EEIYLTPVQRPPDPAEPNSAFLPPAESRMSVSSDPDPAAYPATAGRPHPSISEEDEGFDC
LSSPERAELPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRP
CFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPRPRPPACLSEDSTPDEPDVHFSK
KFLNVFMSGRSRSSSAESFGLFSCVINGEEQEQSHRAVFRFVPRHEDELELEVDDPLLVE
LAEDYWYEAYNMRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFF
QLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEESTKALAESVGRAFQQFYKQFV
EYTCPTEDIYLE
Download sequence
Identical sequences ENSTTRP00000000979 ENSTTRP00000000979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]