SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001612 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001612
Domain Number 1 Region: 2-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.02e-80
Family BAR domain 0.0000000195
Further Details:      
 
Domain Number 2 Region: 274-350
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-23
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001612   Gene: ENSTTRG00000001705   Transcript: ENSTTRT00000001707
Sequence length 354
Comment pep:novel genescaffold:turTru1:GeneScaffold_303:127857:132251:-1 gene:ENSTTRG00000001705 transcript:ENSTTRT00000001707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTMLNTVS
KIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEV
KQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQAMEKFEESKE
VAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELADKLKRRMREASSRPKREY
KPKPREPLDLGEPEQSNGGFPCATAPKITASSSFRSSDKPTRTPSSRSMPPLDQPSCKAL
YDFEPENDGELGFHEGDIITLTNQIDENWYEGMLHGQSGFFPLSYVEVLVPLPQ
Download sequence
Identical sequences ENSTTRP00000001612 ENSTTRP00000001612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]