SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001935 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001935
Domain Number 1 Region: 721-778
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.69e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000418
Family Somatomedin B domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001935
Domain Number - Region: 64-136
Classification Level Classification E-value
Superfamily E set domains 0.000266
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001935   Gene: ENSTTRG00000002059   Transcript: ENSTTRT00000002059
Sequence length 820
Comment pep:novel genescaffold:turTru1:GeneScaffold_3218:259489:266174:1 gene:ENSTTRG00000002059 transcript:ENSTTRT00000002059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSLLPWTLLLLVTAPDPGPWPAAGAQGSCSYRCGVQDGPCSCHPTCFGLASCCSDIRD
FCLEILPYSGSIMGGKDFVIQHLNWSNPTDSVICSFKESIQTRGFVDSSGRVHCVSPLLY
ETGRIPFTLSMDNGRSFPRSGTWLAVHPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXKPYSREWTAAWSYLYSLATSITNSGSFTFTPKPAPQDY
QRWKVGALRIVNSKHHAGEKDVHALWSNEHALAWHLGDDFRADPVAWARAQCLAWEELED
QLPNFLEEVPDCPCTLAQAQADSGRFQADYGCDIEHGSVCTYHPGAVHCVRSVQASPLYG
SGQQCCYTAAGTQLLTADSTSGSTPDRGHDWGAPPYRVPPRVPGLSHWIYDVISFYCCCL
WAPECSRYMQRRPSSDCHSYQPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEASGTDL
RLQARAQTRMTPEGSQDRGTGLTAVAVQEGNSDVVKVRLKDAGALQVLLNQEVLSFKEQS
WMDLKGMFLSVAAGDRVSVMLSSGAGLEVSVQGPFLSVAVLLPDKFLTHTRGLLGTLNDN
PSDDFTLRSGQVLPPSASSQELFQFGADWAVENASSLLTYDSKFLVENFLLQPKHDPSFL
PLFPEETTSSPSQESEAAKLCGDNNFCNFDVAATGSLSVGNATLLVHRQHLLRAQSLQPV
VSCGWLPPPSNGHKEGMRYLVGSTVHFHCDSGYSLAGAEASTCQTDGTWSQPTPTCQRGR
SYAVLLGVIFGGLAVVALVALVYVLLCRRKSNTAVWGSQP
Download sequence
Identical sequences ENSTTRP00000001935 ENSTTRP00000001935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]