SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002153 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002153
Domain Number 1 Region: 443-632
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-43
Family cAMP-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 209-438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-25
Family Voltage-gated potassium channels 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002153   Gene: ENSTTRG00000002291   Transcript: ENSTTRT00000002296
Sequence length 779
Comment pep:novel genescaffold:turTru1:GeneScaffold_1113:266826:408969:-1 gene:ENSTTRG00000002291 transcript:ENSTTRT00000002296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTIRFNKVKPSDGSDENQGSDPSSKSQQPTRQGENKNEKKSLKTKMPPVSAEESYT
KIQDKICEKNTLEDKTTNPDSQNPAESTGTKPEQKEMGSGKEALVSPKSKPLGAPVINEY
ADAQLHNLVRRLRQRTDFYKRKLVEGDMSSPEGSPQTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXRFYLLWLLLVTIAFNWNCWLIPLRIIFPYQTP
NNARYWLITDIICDAIYLFDLLLIQPRLQFIRRGDIIVDSNELKRHYWSSTKFQLDVASI
MPFDVFYLFFGFNPIFRTNRMLKYTSFFEFNHHLESIMNKAYIYRGIRTTGYLLFTLHIN
ACMYYWASNYEGIGTTRWVYDGEGNKYLRCYYWAVRTLITIGGLPEPQTSFEIVFQLLNF
FSGVFVFSSLIGQMQDVIGAATANQSNFRTCMDHTIAYMNTYSIPKIVQNRVRTWYKYTW
DSQRMLDESDLLETLPTTMQLALTIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSIVYLP
GDFVCKKGEIGKEMYIIKQGEVQVLGGADGAQVLVTLKAGAVFGEISLLAARGGNRRTAN
VVAHGFANLLTLDKRTLQEILVHYPDSEKLLMKKARVLLKNKAPGTETTCPNKGLAFLFP
PKQETPKKFKALLGGSGKAGLARLLALKREQTVLKKSENSEEEDKGKKYEDKGRQPAEKP
LETSKCRTSSITAEEAHQSIRRAVLPRGTTRQSLIISMAPSAEAGEEVLLIEVKEKAKP
Download sequence
Identical sequences ENSTTRP00000002153 ENSTTRP00000002153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]