SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002534 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002534
Domain Number 1 Region: 992-1100
Classification Level Classification E-value
Superfamily PH domain-like 6.82e-19
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002534   Gene: ENSTTRG00000002704   Transcript: ENSTTRT00000002704
Sequence length 1117
Comment pep:novel genescaffold:turTru1:GeneScaffold_3518:287562:341386:1 gene:ENSTTRG00000002704 transcript:ENSTTRT00000002704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQRKMAERPTPAARSATHAKRVREPLSEASNQQPLSGGEEKS
CTKPSPSKKRCSDTEVEVSNLKMKNRVESASAPCSPSPMSLHKRPQTPAGVSDSVAAPAS
LLGVRRGLNSRLEGTAASSVKTRMQKLAEQRRHWDSGDVTDDIHESSPFSAMPSEATSPP
KPSLSDASATPVGRKGRLANLAATICSWEDDVKNSSAKQNSVQEQPGTTCLSKFSSASGA
SARINSSSVKQEATCCSQRDGDASLNKASSSSAVGASLINVAISSSGKATSSPVKSSTTS
ITSAKNCEVQNPELLQKTSVSPLKTEVSKSTERSPVSRTVRPKEELNREICLQSQPKNKS
TTPGGAGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQNASSSTTH
LAQQLKQERQKELACLRGRFDKGSLWSAEKGENSRSKQLETKQEIHCQNTPLRKQVGPNT
PSLPVTEKVTENQTPAQPSSIEPTGFTECEMTKSSPLKITLFLEEEKSLKVTSDPKVEQL
TEVVREIEMSVDDDINSSKVINDIFSDVLEEGELDVEKSQEEMDNADAESSEQEDALNIS
SMSLLAPLAQTVGVVSPENLVSSPSWELKDTSISDESPKPGKFQRTRVPRAESGDSIGHE
GHDLPYSIDAYRSQRVKETDRPSIKQVIVRKEDVTSKLNEKKNGFPCQVNIKQKMQELNN
EINLQQTVIYQASQALNCCVDEDHGKGSLEEAEAERLLLIATEKRTLLIDELNKLKNEGP
QRKNNAGPISQSEFVPSKGSITLSEIRLPLKADFVCSTVQKPDAANYYFLIILKAAENMV
ATPLASTSNSLNGDATFTTTFTLRDVSNDFEINIEVYSLVQTKDPSGPDKKKKAYKSKAI
TPKRLLTSVTTKSTLPSSVMASLNAVRTSNFALVGSYMLSLSSVGNTKFALDKVPFLSPL
EGHIYLKIKCQVXXXXXXXXXXXTIFEDVSGFGAWHRRWCVLSGNCISYWTYPDDEKRKN
PIGRLNLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTLCVTKNWL
SADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP
Download sequence
Identical sequences ENSTTRP00000002534 ENSTTRP00000002534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]