SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002786 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002786
Domain Number 1 Region: 27-495
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-128
Family L-arabinose binding protein-like 0.00000000000325
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002786
Domain Number - Region: 504-552
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00612
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002786   Gene: ENSTTRG00000002975   Transcript: ENSTTRT00000002970
Sequence length 1199
Comment pep:novel genescaffold:turTru1:GeneScaffold_2564:15636:482830:-1 gene:ENSTTRG00000002975 transcript:ENSTTRT00000002970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLLILSVLLLKDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVR
EQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSE
EEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSD
KTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGIC
IAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLL
LGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQH
RFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPG
YAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDY
INVGSWDNGELKMDDDEVWSKKSHIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENE
YVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTAVF
IIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSA
LVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIIALFIMEPPDIMH
DYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTT
CIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTST
VVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGN
GGRATMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSMERRVC
AGRFSGAGTGVAVSGVSFPPDTGLKALYDVVEAEEHFPAPARPRSPSPISTLSQRAGSAG
RTDDDLPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMMLSTAAPGPGAGAPL
CSSYLIPKEIQLPTTMTTFAEIQPLPAIEITGGAQPAAAAPPAGGAAREPPAAGPEAAAG
KPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLIIRDYTQSSSSL
Download sequence
Identical sequences ENSTTRP00000002786 ENSTTRP00000002786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]