SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002958 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002958
Domain Number 1 Region: 168-367
Classification Level Classification E-value
Superfamily E set domains 5.13e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000818
Further Details:      
 
Domain Number 2 Region: 65-184
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-25
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002958   Gene: ENSTTRG00000003155   Transcript: ENSTTRT00000003155
Sequence length 427
Comment pep:known scaffold:turTru1:scaffold_109716:107728:109008:1 gene:ENSTTRG00000003155 transcript:ENSTTRT00000003155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSVRTNRYSIVSSEEDGMKLATLAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSSANSFCYENEVALTSKEEEDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
Download sequence
Identical sequences ENSTTRP00000002958 ENSTTRP00000002958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]