SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003119 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003119
Domain Number 1 Region: 481-698
Classification Level Classification E-value
Superfamily TPR-like 2.09e-30
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 661-801
Classification Level Classification E-value
Superfamily TPR-like 2.49e-21
Family Tetratricopeptide repeat (TPR) 0.0093
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003119
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0289
Family mono-SIS domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003119   Gene: ENSTTRG00000003326   Transcript: ENSTTRT00000003326
Sequence length 915
Comment pep:novel genescaffold:turTru1:GeneScaffold_1561:8225:55120:1 gene:ENSTTRG00000003326 transcript:ENSTTRT00000003326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADINLKEVTLIIGVVAACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLFSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNRSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTKSKGPDNSIVWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLCTTAGQFLRGKGSIPFSMLQTLIKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESFLDIRNLATFIFFCFLGALGVFSLRYPGNSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISNKSVLKKLSWVCLSMVILTHALK
TLHRNWDWESEYTLFMSALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDI
GAHMNVGRTYKNLNRTKAAEESYMTAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPVKAKEAYLKALELDKNNADLW
YNLAIVHIELKEPNEALKNFNHALELNPKHKLALFNSAILMQESGEVKLRPEARKRLLSY
VNEEPLDANGYFNLGMLAMDDKKDTEAEMWMKKAIKLQADFRSALFNLALLYSQTAKELM
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFEKILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLVETLALAPHEEYIQRHLNIVRDKISSSSFVEQPVFPAGKTSDIEGD
KIPTENEKEIKSKPRPIQIIKTSDNKSQSKSNKQLGKNTDKETPHKTTKEIKEIEKKRVA
ALKRLEEIERILNGE
Download sequence
Identical sequences ENSTTRP00000003119 ENSTTRP00000003119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]