SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003528 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003528
Domain Number 1 Region: 169-365
Classification Level Classification E-value
Superfamily E set domains 8.4e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000114
Further Details:      
 
Domain Number 2 Region: 64-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.27e-20
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003528   Gene: ENSTTRG00000003758   Transcript: ENSTTRT00000003756
Sequence length 501
Comment pep:novel genescaffold:turTru1:GeneScaffold_2271:83022:132052:1 gene:ENSTTRG00000003758 transcript:ENSTTRT00000003756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT
Download sequence
Identical sequences A0A0P6JH74
XP_004276847.1.21590 XP_004629530.1.9945 XP_004674704.1.23501 XP_004835990.1.39548 XP_019777826.1.83887 ENSTTRP00000003528 ENSTTRP00000003528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]