SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003616 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003616
Domain Number 1 Region: 930-1078,1116-1193
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-23
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 500-647,681-725
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-21
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number 3 Region: 1246-1442,1470-1494
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-21
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 112-257,327-390
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.79e-17
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003616
Domain Number - Region: 1500-1545
Classification Level Classification E-value
Superfamily EF-hand 0.000665
Family Penta-EF-hand proteins 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003616   Gene: ENSTTRG00000003838   Transcript: ENSTTRT00000003845
Sequence length 1676
Comment pep:novel genescaffold:turTru1:GeneScaffold_2589:181738:248619:-1 gene:ENSTTRG00000003838 transcript:ENSTTRT00000003845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPERKGLVPFTRESLEVMEQHSAKKHSEEHKEDLKPNTDLEAGKELPFVYGNLPRAMV
SEPLEDVDPYYKNKMTFIVLNKKRTVFRFSATWCTLSPFNSVRRTAIKILVHPFFRLLIL
ISILIDCIFMSMTDLPKWGPALQNTLLGIYTFEILVKLIARGIWAGSFYFFGDPWNWLDF
SVTLFEHISRYSPPNFISIFRITRNLRILKIIPLNQGLKSFVGILIHCLKKLTGVIILTL
FFLSIFSLIGMELFMGNLKHKCLRWPQENETETLHNRTGNPYYIRETENFYYLEGERYAL
LCGNRTDAGQCPEGYVCVKAGVNPDYGYTNFDSFGWTLLALFRLMMQDYPEALYHQILYA
SGKVYMIFFVVISFWFAFYMASLFLGILAISCEEEKQRAAEKAKKIEPELQQALTELQEG
NKAAETKTTEIEMKKRSSTSMITSLDMLDDATIRHKEELRKSRKRCPFCWYRFAKTFLIW
NCSPCWLKLKEFVHMIIMDPFTDLFLTICIILNVHFLALEHYPMSLEMNNILNIENQVFI
GIFTAEMIFKIITMHPYGYFQVGWNIYDSLIVFHGLVELYVTHCHGLAVLRSFRVLRIFK
LGRYWPTFKILLLTLGNSVMALKDLVLLLFTFIFFSAVLGLKLFGSNYKIYVCNIGEDCQ
LPRWHMRDFLHSFLNVFRILCGEWIETLWDCFKVAGQFSCIPFYMMVILVGNLLILYVLA
LVSSFSSYKAATTEENDEAKNLQRAMARIKKGINYVLSKILCKNQNVPEETMDNVSDIYV
KENISDHTLSELSNTQEFLKDKEKSSGTEKNTMTENGSQSLIPSPSVSETVPIASEESDI
ENLNNKEIQSKSGDGSSKEKVKQSSSSECSTVDISISEEEEMVYERGKPKRLKNGYGRRS
SSAQISRDSRKRKIWQNIRKTCCKIVENSCFKCFIGLVTLLSTGALAFEDIYIDQRKTIK
ILLEYGDMIFTYIFILEMLLKWMAYGFKAYFTNGWYQLDFMVVIVFCLSLIGKSREELKP
LISIKFLRALRVLSQFERMKVVVRALVKTTLPTWNVLLVCLMIWLAFSIIGVHLFAGTFY
ECIEPTSGERFPISEVMNRSQCESLVFNESMPWENAKLNFDNVGISFLSLLQVATFNGWI
TIMNSAVDSIGVDMQPNFEDNIYMCCYFIDFIIIGLFLPLSMLIGAIIANFNKHKVKLGG
SNIFITVKQKKQYHALKKLMCEVSQKPVPRPGNKFQGFVFDLVTNKVFNIIIMVLIFFQA
ITIMIQSDEQNPKIDIAVYWINSVFVTLYTGECVLKLIVFRYNYFTNGWNLFDFMVVVFS
MTGLFLPLMVGYYLVPPSLVQLILLSRIIHILRPEKGPKVFHDLLLPLVLSLPALLNISL
LIFLIMFVYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVTIFAGWDGMLNAIFN
SKWSDCDPDKINPGTQVRGDCGNPFVGIVYFVSYILISWLIIVNMYIVVVMEFLNIASKK
KAKTLSEDDFRKFFQVWKRFDPDRTQYIDSSKLSDFAAALHPPLFMAKPNKGQIVAMDLP
MAVGDRVHCLDILLALTKRVMSQDVSMEKVLSEVESGFMLANPFKITYEPITTTLKRKQE
AVSATIIQRAYKSYRLRQNDKKTSDIHMIDGDVEVQAIKEGSYFDKTEGKSTISQI
Download sequence
Identical sequences ENSTTRP00000003616 ENSTTRP00000003616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]