SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004117 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004117
Domain Number 1 Region: 78-137
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-25
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 2 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 338-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 253-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000206
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004117   Gene: ENSTTRG00000004375   Transcript: ENSTTRT00000004373
Sequence length 394
Comment pep:novel genescaffold:turTru1:GeneScaffold_3363:133174:325850:1 gene:ENSTTRG00000004375 transcript:ENSTTRT00000004373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVRTAAVWVPPLQEQESTCDGTRKLQGEKSILGQETPDQRPLPGGPRQRHKSPGTEQ
VLEWLFISQEQPKAKKTWGPLSFMDVFVDFTWEEWQLLDPAQKHLYRSVMLENYSNLVSL
GYQHTKPNIIFQLEQEELWMMQIPSEGHMDEVWEIDGHMEWHKENQGKLRSMSKGYQCTT
FGKLCLLSTDYVSSRQKLHKCVTNGKSLKYSTDFGNNFSRKNNGFHAHRESSFHSKHEQA
VIGIKYCESNKSGKTANRKSQLICQQIRMGGKPFECSYCGKAFSSKSYLVVHQRTHAKEK
PYKCNGCGKDFSSKSYLIVHQRTHTGEKLHECSVCQKTFSFNSQLVIHQRIHTRENPYEC
CECGKVFNRKDQLVSHQRTHSGQKPYGCHDCGKA
Download sequence
Identical sequences ENSTTRP00000004117 ENSTTRP00000004117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]