SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004654 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004654
Domain Number 1 Region: 23-195
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000000937
Family G-type lysozyme 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004654   Gene: ENSTTRG00000004942   Transcript: ENSTTRT00000004938
Sequence length 195
Comment pep:novel genescaffold:turTru1:GeneScaffold_2650:77006:80828:-1 gene:ENSTTRG00000004942 transcript:ENSTTRT00000004938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSRGSCSFTLSMNPRLRSCLYRGCYGTIMTMETSAATCDITGVIAGSICGFEMFAEMDLK
VFKSYILIKEVRLRHCMDPALTAAIISRESHGGTIRQDGWDHKGLKFGLTQLDKKKYRPV
GTWDSKEHLLQAVGILTDRIKANQKKFPTWSVAQYLKGGLSGFKSGTEATATPADIDDVI
SDIIARAKFYKRHGF
Download sequence
Identical sequences ENSTTRP00000004654 ENSTTRP00000004654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]