SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005250 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005250
Domain Number 1 Region: 1531-1781
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-39
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 2 Region: 760-907,941-988
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 128-273,363-432
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 4 Region: 1208-1350
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-26
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000005250
Domain Number - Region: 1421-1481
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00011
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number - Region: 1790-1835
Classification Level Classification E-value
Superfamily EF-hand 0.00694
Family Calmodulin-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005250   Gene: ENSTTRG00000005563   Transcript: ENSTTRT00000005564
Sequence length 2006
Comment pep:novel scaffold:turTru1:scaffold_109764:74434:165640:1 gene:ENSTTRG00000005563 transcript:ENSTTRT00000005564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSVLVPPGPDSFRFFTRESLAAIEQRIAEEKAKRPKQERKDEDDENGPKPNSDLEAGK
SLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAISRFSATPALYILTPFNPIRK
LAIKILVHSLFNVLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKILARGFC
LEDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGA
LIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPDNSSFEINITSFFNNSL
DGNGTTFNRTVSMFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNP
NYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLI
LAVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAAAAAASAESRDFSGAGGI
GVFSESSSVASKLSSKSEKELKNRRKKKKQKEQSGEEEKEDGVHKSESEDSIRRKGFRFS
LEGSRLTYEKRFSSPHQSLLSIRGSLFSPRRNSRASLFSFRGRAKDIGSENDFADDEHST
FEDNDSRRDSLFVPHRHGERRPSNVSQASRASRVLPVLPVNGKMHSAVDCNGVVSLVGGP
SALTSPAGQLLPEGTTTETEIRKRRSSSYHVSMDLLEDPTAKQRATSMASILTNTMEELE
ESRQKCPPCWYKFANMCLIWDCCKPWLKVKHLVNLVVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLSVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGLIVSLSLMELG
LANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKISNDCELPRWHMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LTVFMMVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKR
KIREFIQKAFVRKQKALDEIKPLEDLNNKKDSCISNHTTIEIGKDLNYLKDGNGTTSGIG
SSVEKYVVDESDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESDMEESKEKLNATS
SSEGSTVDIGAPAEGEQPEVEPEESLEPEACFTEDCVRKFKCCQISIEEGKGKLWWNLRK
TCYKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLL
KWVAYGFQVYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLRALSR
FEGMRVVVNALLGAIPSIMNVLLVCLIFWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATFKGWMDIMYAAVDSRNVEL
QPKYEDNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYN
AMKKLGSKKPQKPIPRPANKFQGMVFDFVTKQVFDISIMILICLNMVTMMVETDDQSQEM
TNILYWINLVFIVLFTGECVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAELIEKYF
VSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGM
SNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSGPPDCDPEKDHPG
SSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFY
EVWEKFDPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILF
AFTKHVLGESGEMDALRIQMEERFMASNPSKVSYEPITTTLKRKQEEVSAIVIQRAYRRY
LLKQKVKKVSCIYKKDKGKEGDGTPIKEDILTDKLNENSTPEKTDVTPSTTSPPSYDSVT
KPEKEKFEKDKSEKEDKGKDIRESKK
Download sequence
Identical sequences ENSTTRP00000005250 ENSTTRP00000005250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]