SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005277 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005277
Domain Number 1 Region: 178-363
Classification Level Classification E-value
Superfamily E set domains 9.8e-69
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000443
Further Details:      
 
Domain Number 2 Region: 59-133
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000726
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005277   Gene: ENSTTRG00000005593   Transcript: ENSTTRT00000005593
Sequence length 389
Comment pep:novel scaffold:turTru1:scaffold_113118:22819:26764:1 gene:ENSTTRG00000005593 transcript:ENSTTRT00000005593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDASGQNMFKMLVVLERMFKHLQKWFVTHFLGRSAQRARLVSKDGRCNIEFGNVEAQSRL
IFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTPCV
EHINGLTSAFLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI
SRPKQRAKTVTFSKHAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTITPEGETI
ILDQININFVVDAGNENLFFISPLTIYHVIDHTSPFFHMAAETLPQQDFELVVFLDGTVE
STSATCQVRTSYVPEEVLWGYRFAPMVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNE
KDAQARMKRGYDNPNFILSEVSETDDTKM
Download sequence
Identical sequences ENSTTRP00000005277 ENSTTRP00000005277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]