SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006420 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006420
Domain Number 1 Region: 385-603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.82e-18
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 36-203,259-328
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000541
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 885-909,960-1041,1093-1160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000761
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 1246-1450
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000863
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006420   Gene: ENSTTRG00000006784   Transcript: ENSTTRT00000006789
Sequence length 1737
Comment pep:novel genescaffold:turTru1:GeneScaffold_575:227935:506118:-1 gene:ENSTTRG00000006784 transcript:ENSTTRT00000006789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMT
FEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWV
SLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWS
VSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCP
PGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYF
YFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDSAGGWQ
LVAVDVNKPQGRAPACLQQMMRSSVFHMFILSMVTVDVIVAASNYHKGETFRRQYDEFYL
AEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVL
RVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTF
PRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILD
NLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRE
SFMKQFIDRQQQDTCCLLRSLPSTSSSSCDHSKRSAIEDKYIDQKLRKSVFSIRARNLLE
KETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGKS
LETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVG
REHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCI
SMMFESPFRRVMHAPTLQIAEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVSLIFLCWMPQNVPAESGAQLLLVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVS
ILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEKK
PGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPMHGIYIHVFVF
LGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFRA
KMYDITQHPFFKRTIALLVLAQSVLLSVKXXXXXXXXXXXXXXXXXXXFIFVLEVTMKII
AMSPAGFWQSRRNRYDLLVTSLGIVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTL
KMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITV
LFRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNL
LVAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGRL
EVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLEY
TIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPSE
DLNANSQDNNMQPETSSRQRLLSPTLSDRGASRQDAAEAGKPQRKFGQWRLPSAPKPISH
SVSSVNLRFGGRTTMKSVVCKMNPMTDTASCGSEVKKWWTRQLTVESDESGDDLLDI
Download sequence
Identical sequences ENSTTRP00000006420 ENSTTRP00000006420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]