SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006482 from Tursiops truncatus 69_1

(show help)
Strong hits

Sequence:	ENSTTRP00000006482
Domain Number 1	Region: 4-63
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	2.75e-24
Family	KRAB domain (Kruppel-associated box)	0.00083
Further Details:

Domain Number 2	Region: 206-263
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.11e-20
Family	Classic zinc finger, C2H2	0.015
Further Details:

Domain Number 3	Region: 248-298
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	6.37e-18
Family	Classic zinc finger, C2H2	0.0093
Further Details:

Domain Number 4	Region: 164-216
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.71e-16
Family	Classic zinc finger, C2H2	0.01
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSTTRP00000006482 Gene: ENSTTRG00000006856 Transcript: ENSTTRT00000006856
Sequence length	299
Comment	pep:novel scaffold:turTru1:scaffold_87144:32371:36720:-1 gene:ENSTTRG00000006856 transcript:ENSTTRT00000006856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEPLESVTFEDVAINFTQEEWALLDTSQKTLFRNVMLENITHLVSVGYQISKSDVISQLE QGKELWSEATGCLQGQSPDGESPLRREMIFTQSVYRKHIFATMPMQVSHTQGDPVGWTDL SDEFTPRSSPQHSPIPLRRKSNVSKQHGKSLSQGSFLDGQDHIHTRAKSFECPLCGKAFS TGFRLRQHKMIHTEEKQYKCHVCGKVFNQSSLVKRHEKTHTGEKPYECCLCKKTFSQISY LRKHEKIHPREKPYECHLCGKTFNQRSGLRTHNKIHTGEKPHVCLLCGKAFTQTSDLRR
Download sequence
Identical sequences	ENSTTRP00000006482 ENSTTRP00000006482

SEARCH