SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006483 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006483
Domain Number 1 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.52e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-24
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 3 Region: 153-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 108-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000123
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006483   Gene: ENSTTRG00000006857   Transcript: ENSTTRT00000006857
Sequence length 271
Comment pep:novel scaffold:turTru1:scaffold_87144:70108:74488:-1 gene:ENSTTRG00000006857 transcript:ENSTTRT00000006857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPVESVTFEDVAISFTQEEWALLDTSQRKLFRDVMLENISHLVSVGYQHCKSDVIFQLD
QGEELWIEGRGFFQSHSPGRESALKEMLATQHISRKDTSTTIPLASSHTPEDPFECNDLG
EDFTHSSTLSQHLLTHTEKTPCINKQCKKSLSDQSYLNQHKQIHTRGKSCECHLCGKAFS
NCSSLRRHEMTHTGEKPYECHICGNAFIQSSDLRKHNLTHTGEKPYECHLCGKAFSQSSN
LRQHERTHTGEQPYECQLCGKAFSKCSALRR
Download sequence
Identical sequences ENSTTRP00000006483 ENSTTRP00000006483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]