SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006829 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006829
Domain Number 1 Region: 13-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-25
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 188-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 313-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 134-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 234-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000767
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006829   Gene: ENSTTRG00000007217   Transcript: ENSTTRT00000007215
Sequence length 479
Comment pep:novel scaffold:turTru1:scaffold_92694:32199:42749:1 gene:ENSTTRG00000007217 transcript:ENSTTRT00000007215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVRRRHTSSLGEASLSFEDVAVHFTWEEWQLLDPSQKDLYRNVMWENYCNLVSVGYQTP
KPDSFFQLEQGEPPWTVEGAGQSQTCPGFVIENRRYAGKDSDEFSGYGKSSLYLQHNRTL
TRIKYHGCVKPSSTKSQLDDHQKIYPGKKPHICSECGKAFSRKAELVRHQRTERGEKPHG
CNECGKKFLRKIQLTEHQRTHTGEKPHECNECEKAFSRKSQLMVHQRTHTGEKPYGCSEC
GKAFSRKCRLNRHQRSHTGEKLYGCNVCGKAFSQKSYAVAHQRLHTGEKPYECRECGKTF
FFKSDLTKHQRIHTGEKPYECSDCGKAFRSKSELIQHQRTHTGERPYACSECGKAFAHMS
VLTKHKKTHKRKKAVDSPKLEKSSSVSHSSLFISELIQEQNPMNAVPVEMSFTGTQPLLN
ISEFLGDRNVVIVDQPFSRSQASVENREFTQGLSLANTVNVTTPSVINYVLYVTDIVEK
Download sequence
Identical sequences ENSTTRP00000006829 ENSTTRP00000006829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]