SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007001 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007001
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.02e-27
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 494-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 382-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 550-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 213-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-20
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 10 Region: 178-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000256
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007001   Gene: ENSTTRG00000007401   Transcript: ENSTTRT00000007400
Sequence length 652
Comment pep:novel scaffold:turTru1:scaffold_108684:10466:23547:-1 gene:ENSTTRG00000007401 transcript:ENSTTRT00000007400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQAQETLSFKDVAVDFTWEEWQLLDPSQKDLYRDVMLENYSNLLSVGYRVSKPDAMSKL
ERGEEPWTIEDEIHSQTCPETGNVGNHLQGDWENQRMLKGIEQYQEHNAFGNPVPQSKSH
FSFRQNHDMFEFYIKTLKSHLSLVSQGQSYEIKNSTKCNGDGKSFLHGKPEEFHSSVQCP
VSAKSISTKSQVIKHQGTHNAEKAHICSECGKAFVKKSQLTDHQRVHTGEKPYGCSMCAK
VFSRKSRLNEHQRIHKREKSFICGDCGKVFTMKSRLIEHQRTHTGEKPYICSDCGKAFPG
KRNLIVHQRNHTGEKCYICNECGKGFTGKSMLTIHQRTHTGEKPYICSECGKGFTTKHYV
IIHQRNHTGEKPYICNECGKGFTMKSRLIEHQRTHTGEKPYVCNECGKGFPRKNNLIVHQ
RNHTVEKSYVCGECGKGFTVKSMLIIHQRTHTGEKPYICSECGKGFPLKSRLVVHQRTHT
GEKPYRCSECGKGFIVNSGLMLHQRTHTGEKPYICNKCGKGFAFKSNLVVHQRTHTGEKP
FTCNECGKGFTMKRYLIIHQQIHMGEKSYICSECGKGFVMETELILHQQIHTGEKPYACN
ECGRGFTVKSRLVIHQRTHTGEKPFVCSECGKAFSSKRNLIVHQRTHNGNKS
Download sequence
Identical sequences ENSTTRP00000007001 ENSTTRP00000007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]