SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007173 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007173
Domain Number 1 Region: 1859-2103
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-53
Family Ankyrin repeat 0.0000000486
Further Details:      
 
Domain Number 2 Region: 453-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000102
Family EGF-type module 0.00045
Further Details:      
 
Domain Number 3 Region: 1170-1312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 4 Region: 412-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000331
Family EGF-type module 0.00028
Further Details:      
 
Domain Number 5 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000181
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 6 Region: 290-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000129
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 983-1101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 8 Region: 791-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000219
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 9 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000274
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 258-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000274
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 491-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 12 Region: 857-987
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000973
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 641-757
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000013
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 14 Region: 178-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 15 Region: 1141-1184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000578
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 220-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000332
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 17 Region: 106-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.021
Further Details:      
 
Domain Number 18 Region: 1528-1560
Classification Level Classification E-value
Superfamily Notch domain 0.000000196
Family Notch domain 0.0045
Further Details:      
 
Domain Number 19 Region: 1308-1352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.014
Further Details:      
 
Domain Number 20 Region: 1492-1521
Classification Level Classification E-value
Superfamily Notch domain 0.000000732
Family Notch domain 0.0048
Further Details:      
 
Domain Number 21 Region: 1109-1149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000274
Family EGF-type module 0.026
Further Details:      
 
Domain Number 22 Region: 1345-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000524
Family EGF-type module 0.016
Further Details:      
 
Domain Number 23 Region: 1390-1427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000068
Family EGF-type module 0.019
Further Details:      
 
Domain Number 24 Region: 529-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000727
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 25 Region: 832-868
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000089
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007173
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000475
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 61-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000686
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007173   Gene: ENSTTRG00000007583   Transcript: ENSTTRT00000007584
Sequence length 2527
Comment pep:novel genescaffold:turTru1:GeneScaffold_711:274408:322100:-1 gene:ENSTTRG00000007583 transcript:ENSTTRT00000007584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLLAPMLCLALLPALAARGLRCSQPSETCLNGGKCEVFPNGTEACVCSGAFAGQRCQA
PNPCLSAPCKNGGTCHAVERDGXXXXXCRCRLGLSGPLCLTPRDHACLASPCLNGGTCDL
LTLTEYKCLCPPGWSGKTCQQADPCASNPCANGGQCLPFEASYICGCPPGFHGPTCRQDV
NECSQNPGLCHHGGTCHNEVGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
AHECACLPGFTGQNCEANIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQHCTEDVDEC
QLMPNACQNGGTCHNAHGGYNCVCVNGWTGEDCSENIDDCASASCFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICM
PGYEGVHCEVNTDECASSPCLQNGRCLDKVNEFVCECPTGFTGHLCQYDVDECASTPCRH
GAKCLDGPNTYACVCAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNCEILDDCASNPCDSGTCLDKID
GYECVCEPGYTGSVCHINIDECADNPCHNGGTCEDGVNGFTCRCPEGYHDPTCLSEVNEC
SSNPCIHGACRDSLNGYKCDCDPGWSGANCDINNNECESNPCVNGGTCKDMTSGYVCACR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYAGATCEVVLAPCAPGPCRN
GGECKESKDYESFSCACPVGCPGQTCEIDINECVKSPCRAGASCQNTNGGYRCHCQAGYT
GRNCETDVDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSRPCLHGGTCHDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGRCWQTNAL
YRCECHSGWTGLYCDVPSVSCEVAAWQQGINVTHLCRNGGLCMNVGDTHHCHCQAGYTGS
YCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEVNECLSQPCRNGGTCID
LTNTYKCSCPRGTQGVHCEINVDDCNPPIDPVSRGPRCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNAFHCECRAGHTGRRCESVINGCKDRPCKNGG
SCAVASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPVSSPCMGGNPCYNQGSCEPTSESPFYRCLCPAKFNGLLCHIDYSFGGGVGLDIP
PPQIAEACELPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCWKYFS
NGRCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGLDC
AEHVPERLAAGTLVLVVLMPPEQLRNHSLHFLRELSRLLHTNVVFKRDASGQQMIFPYYG
REEELHKHPIRRSVDGGASLLPGSGGGRRRRELDPMDIRGSIVYLEIDNRQCVQSSSQCF
QSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAPLHFMYVAVVAFVLLFFVGCG
VLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALVDDNQSEW
GDEGLEAKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRVSAMAPTPPQGEADTDCMD
VNVRGPDGFTPLMIASCSGGGLETGKSEEEEDAPAVISDFIYQGASLHSQTDRTGETALH
LAARYSRSDAAKRLLEAGADANIQDNMGRTPLHAAVAADAQGVFQILIRNRATDLDARMH
DGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVEAAVVLLKNGAN
KDMQSNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLL
DEYSLVRSPPLHGTPTLSPPLCSPSGYLGNLKPAVQGKKARKPSTKGLACGGKEPKDLRA
RRKKSQDGRGCLLDSSSALSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMPLNHLPGMP
EAHLGVSHLSVAAKPEMAALSGGGRLAFEAGPPRLSHLPVASGTSTVLGAGGSGSCGGAV
NFTVGGAAGLNGQCEWLSRLQNGLVPNQYNPLRGSVAPGTLSTQAPALQHGMVGPLHGGL
SATALSQMMSYQALPSTRLAAQPHLVQPQQQQQNLQMQPPNMQPQAPQPHLGVGSATSGH
MARSFLAGELSQADVQPLGPGSLAAHTVLPQDSQVLPTSLPAALAPPMTTAQFLTPPSQH
SYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSMPSQIA
HVPEAFK
Download sequence
Identical sequences ENSTTRP00000007173 ENSTTRP00000007173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]