SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007963 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007963
Domain Number 1 Region: 857-1052
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.71e-40
Family cAMP-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 623-848
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.71e-16
Family Voltage-gated potassium channels 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007963   Gene: ENSTTRG00000008385   Transcript: ENSTTRT00000008402
Sequence length 1120
Comment pep:novel genescaffold:turTru1:GeneScaffold_3199:47254:114562:-1 gene:ENSTTRG00000008385 transcript:ENSTTRT00000008402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWVQRVLPQPPGTPVKREEEEGAEPEPELEPEPETAPEETELEEESLPPEEACVGKEV
AEADPGPQETQEAAPSPPTSLQAQAAVVPEANSPSSRVLTWLRKGVEKVVPQPVHSGMEG
PAQILGHCSTGGSADGHSEAPRAQDTGPGPWLLRWLEQNLEKMLPQPPKTSEGWRDEPAD
AALGPEPPGPALEMEPVPQAQESPSLPAPDPPKPEEELTPEPQPGIQASSLPPTQDPARL
MAWLLHRLEMALPQPVVRGKAGEQEPDSPVTCDVQSISILPGEHEEPSLILEDVDPHWEE
YEYQEVSSPRGSEAAPADEEESEEVEQMPRELPQIQEEKEDEEEEDGEEEEADVLLDSCL
VAQGGEDQSGVGGAERQSASHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXPATEEHPELQVEDADADSQPLEENPPSPVPLPPSPAKCDTLGV
PGSATGSLRKRLCSQDDEAEELSPAVSPVVACSDPTSPQGTDDQDRAASTDSQTSALINN
RLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPEPALDVKPAESGQVEEEHY
CEMLCCKFKRRPWKKYQFPQSIDPTTNMYIVWLFFVVLAWNWNCWLIVRWAFPYQMDIHF
LLVDYCDFIYFLDITVFQLRLQFVRGGDIITDKKEMRNNYLKSQRFKMDMLCLLPLDFLY
LKFGVNPLLRLPRCLKYMAFFEFNNRLESILSKAYIYRVIRTTAYLLYSLHLNSCLYYWA
SAYEGLGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPRTLFEIVFQGLNYFTGVFAF
SVMIGQMRDVVGAATAGETYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYTWHSQGMLD
ESELMVQLPDKMRIVLAIDVNYNIVSKALFQRCDRQMIFDRQKRLRSVVYLPNDYVCKKG
EIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTANVIAHGFTN
LFILDKKDLNDILVHYPESQKLLRKKARRMLRNDNKPKEQSVLILPPRPGTPKLFSATLA
ASGKMGAKGAKDGKLAHLRARLKELAALEAAARQQQVLEQ
Download sequence
Identical sequences ENSTTRP00000007963 ENSTTRP00000007963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]