SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008114 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008114
Domain Number 1 Region: 215-408
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-38
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 74-144
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000215
Family RING finger domain, C3HC4 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008114   Gene: ENSTTRG00000008561   Transcript: ENSTTRT00000008559
Sequence length 414
Comment pep:novel genescaffold:turTru1:GeneScaffold_3483:180508:185954:-1 gene:ENSTTRG00000008561 transcript:ENSTTRT00000008559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGDWRRQWLKREAIPGERQKASKVNVGGGERGSDATSSRGAQPPECPKVVAEGTAPGRWL
PMEISEPLGRGLVQRLEQLATCPLCGSLFEDPVLLACEHSFCRACLDRRWGTPPPPGSEA
PPTACPCCGRPCPRRSLRSNVRLAVEVRISRELREKLAEPGARTGKRRGGRIPTMGCLAP
HGEDTKKTWRRFDAPTPKSSNSEDDLPEDYPVVKNMLHRLTADLTLDPGTAHRRLLVSAD
RRRVRLAPPGTPAPRDGPGRFDQLPAVLGAQGFRAGRHCWEVEIADTASRGDSSGEDKDD
GESRYALGVAGESVRRKGRVGLCPVEAVWAMEDRGGRLWALTAPEPTPLGGAGPQPRRIR
VDLDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTCDPRVPLCLVPAEG
Download sequence
Identical sequences ENSTTRP00000008114 ENSTTRP00000008114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]