SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008163 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008163
Domain Number 1 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.33e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 482-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 176-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 2-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 7 Region: 524-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-19
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 8 Region: 385-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 427-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 10 Region: 122-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000215
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008163   Gene: ENSTTRG00000008613   Transcript: ENSTTRT00000008611
Sequence length 581
Comment pep:novel scaffold:turTru1:scaffold_113769:43005:52948:-1 gene:ENSTTRG00000008613 transcript:ENSTTRT00000008611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHWLVTFRDVAINFSQEEWECLDPIQRDLYREVMVENYSHLISLDLEYICETKRSCPEK
GTYEMESLQWENMRKPISHNLECNDLGENTECKGKFEDQQRSQERPYMRMKITCKEEATQ
SHSMSPILHQINPTKEKLYKCKECKQAFSYLSCLIQHEKSHNKEKHSDVKKCRTIFSKKP
TYIQHQRIQNGEKPYECMECGKAFGRSSDLIQHQKIHTNEKPYQCKACGKAFIRGSQLTE
HQRVHTGEKPYECKKCGKAFSYCSQYTLHQRIHSGEKPYECKECGKAFILGSHLTYHQRV
HTGEKPYRCKECGKAFLCASQLNEHQRIHTGEKPYECKECGKAFSRGSQLTYHLRVHTGE
RPYKCKECGKAFISNSNLTQHQRIHTGEKPYKCKECGKAFICGKQLSEHHRIHTGEKPFE
CKECGKTFIRGAYLTQHEKIHGEKHYECKECGKTFFRTTQLTYHQRIHTGEKPYKCKECD
KAFIYGSQLSEHQRIHRGEKPYECKQCGKAFIRGSHLTEHLRTHNGEKPYECKECGKAFS
RGSELTLHQRIHTGEQPYACIQCGKDFRRHSQLIQHMRLHN
Download sequence
Identical sequences ENSTTRP00000008163 ENSTTRP00000008163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]