SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008430 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008430
Domain Number 1 Region: 187-252
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000519
Family Phosphotyrosine-binding domain (PTB) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008430   Gene: ENSTTRG00000008889   Transcript: ENSTTRT00000008889
Sequence length 252
Comment pep:novel genescaffold:turTru1:GeneScaffold_2505:313435:316918:1 gene:ENSTTRG00000008889 transcript:ENSTTRT00000008889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDMDPHQLTGQGRMTSEKTTVTVLCRQQSSGLTPAFSRSWLPLRARKQEPAQDLYQALRT
GSMTQGCLELVSVTAAVISQGGVLQGGLVGGKREGADVKRPSCGVLLAMSEIIRSSKAPP
CVNYRFVCALTGAIPPTAVPAPAPDTLLLWVRDEARRRRREFESADVALGPPRPWACPAD
VRLCGHLRAYPQRLECYESEKKFRAGRAPPKFSVSLEGACTISKRVDARQRHLIVLYTRD
RSLGVAAASEAE
Download sequence
Identical sequences ENSTTRP00000008430 ENSTTRP00000008430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]