SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009192 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009192
Domain Number 1 Region: 5-33,87-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.19e-19
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 153-256
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-19
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009192   Gene: ENSTTRG00000009714   Transcript: ENSTTRT00000009699
Sequence length 313
Comment pep:novel genescaffold:turTru1:GeneScaffold_2525:52720:59683:1 gene:ENSTTRG00000009714 transcript:ENSTTRT00000009699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRGALLAGALAAYIAYLVLGALLVARLERPHEDRLRAELQTLRQQLLQRSPCVAAPALD
AFVERMLAAGRLGRAALANASGSANASDPAWDFASALFFASTLVTTVGYGYTTPLTDGGK
AFSIAFALLGVPATMLLLTASAQRLSLLLSHAPLSWLSRRWGCHPPQAARWHLAVLLGVV
VTICFLVPAAVFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTV
YLFLGLVAMVLVLQTFRRVSDLHGLTELILLPNPCPTSFNEDGDDRVDILGRQPEPHQQF
AADLHPDYASIPR
Download sequence
Identical sequences XP_004284292.1.21590 ENSTTRP00000009192 ENSTTRP00000009192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]