SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010378 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010378
Domain Number 1 Region: 65-256
Classification Level Classification E-value
Superfamily E set domains 3.64e-52
Family Cytoplasmic domain of inward rectifier potassium channel 0.00027
Further Details:      
 
Domain Number 2 Region: 22-81
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000612
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010378   Gene: ENSTTRG00000010950   Transcript: ENSTTRT00000010946
Sequence length 280
Comment pep:novel genescaffold:turTru1:GeneScaffold_1412:218118:221285:-1 gene:ENSTTRG00000010950 transcript:ENSTTRT00000010946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGDLELDHDAPPESTTICVKYITSFTAAFSFSLETQLTFGYGTMFPSGDCPSAIALLAI
QMLLGLMLEAFITGAFVAKIARPKNRAFSIRFTDLAVVAHIDGKPNLIFQVANTRPSPLT
SVRVSAILYQERENGELYQTSVDFHLDGISSEECPFFIFPLTYYHSIIPSSPLATLLQHE
NPPHFELVVFLSAMQEGTGEICQRRTSYLPSEIMLHHCFASLLTRGSKGEYQIKMENFDK
TIPELPTPLVSKSPNRTDLDIHINGQSIDNFQISETGLTE
Download sequence
Identical sequences ENSTTRP00000010378 ENSTTRP00000010378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]