SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010709 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010709
Domain Number 1 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-26
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 444-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 332-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010709   Gene: ENSTTRG00000011297   Transcript: ENSTTRT00000011296
Sequence length 569
Comment pep:novel genescaffold:turTru1:GeneScaffold_75:40275:59645:1 gene:ENSTTRG00000011297 transcript:ENSTTRT00000011296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDLVTFGDVAVDFSQEEWEWLNPAQRNLYRKVMLQNYRSLVSLGVSVSKPDVISLLEQ
GKEPWMVKKEGTRGACPDWEYAFKNNEFSSKQVIYEESSKVRTMGRSHLSYNLDCSNLRE
DSKNEDWFKNHLGSQEIQSSQLIITHKEILTKDQSNEYTKSWQTFHQDAIFDIRQSFPTK
ERIHKHEPRKRSYRKKSVEMKRKKVYVEKKLLKCNECEKVFNQSSSLTLHQRIHTGEKPY
ACVECGKTFSQSANLAQHKRIHTGEKPYECKECRKAFSQNAHLAQHQRVHTGEKPYQCKE
CKKAFSQIAHLTQHQRVHTGERPFECIECGKAFSNGSFLAQHQRIHTGEKPYICNVCGKA
FSHRGYLIVHQRIHTGERPYECKECRKTFSQYAHLAQHQRVHTGEKPYECKVCRKAFSQI
AYLDQHQRVHTGEKPYECIECGKAFSNSSSLAQHQRSHTGEKPYMCKECRKTFSQNAGLA
QHQRIHTGEKPYECNICGKAFSYSGSLTLHQRIHTGERPYECKDCRKSFRQRAHLAHHER
IHTMESFLTLSSPSPSVSSQLPRPVGSIS
Download sequence
Identical sequences ENSTTRP00000010709 XP_019784386.1.83887 ENSTTRP00000010709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]