SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010785 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010785
Domain Number 1 Region: 149-524
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.44e-93
Family Phosphonoacetate hydrolase 0.033
Further Details:      
 
Domain Number 2 Region: 620-852
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 6.47e-25
Family DNA/RNA non-specific endonuclease 0.014
Further Details:      
 
Domain Number 3 Region: 51-99
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000235
Family Somatomedin B domain 0.0042
Further Details:      
 
Domain Number 4 Region: 100-140
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000209
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010785   Gene: ENSTTRG00000011371   Transcript: ENSTTRT00000011374
Sequence length 874
Comment pep:novel genescaffold:turTru1:GeneScaffold_1001:70511:135127:1 gene:ENSTTRG00000011371 transcript:ENSTTRT00000011374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLGLSTEEPVMRNTVKKYKIICIVLLTLLVAVSLALGLVAGLRQHEEQGSCRKKCFD
ASHRGLEGCRCDVQCKGRGDCCWDFEDTCVGPTRIWTCNKFRCGETRLESSLCSCSDDCL
QKKDCCADYKSVCQGDTSWVEEECGTAQQPQCPEGFDLPPVILFSMDGFRAEYLQTWGSL
IPNINKLKTCGIHSKYLRPVYPTKTFPNHYTIVTGLYPESHGIIDNKMYDVHLNKNFSLS
SEEKNNPVWWHGQPIWLTAMYQGLKAGTYFWPGSDVAINGTFPSIYRTYNRSVTYEERVF
TLLKWLDLPKAERPDFYTIYVEQPDSAGHAQGPVSAAVIQALQLVDYTFGLLMEGLKQRN
LVNCVNIILLAEHGMDQTYCDKVEYMTNYFSQTNFYMYGGPAPRIRTLNIPHDFFTFNSE
EIVRNLSCRKPDQHFTPYLTPDLPKRLHYAKNVRIDKAHLLMDRQWQAVRTKPFSSCGGG
NHGYNNEFKSMEAIFLAHGPSFKQQTEVEPFDNIEIYNLMCDLLHIQPAPNNGTHGSLNY
LLKVPFYEPSHAEEVSKFSVCGFTVPVPTDTLGCSCPELQSSADLDRVNQMLNLTQAEIK
TTEKLNLPFGRPRVIQKNKELCLLYHREYVSGFDKTSRMPLWSSYTVPKPGDTSPLPPTV
PDCLRADVRIAPSESQNCSFSLADKNIAHGFLYPPANNRTSDSQYDALITSNLVPMYEAF
KTMWNYFHSVLLVKHAMERNGVNVVSGPIFDYNYDGHFDTPDEITEYVVNTSVPIPTHYF
VVLTSCKNKSQTPNACPGWLDVLPFVIPHRPTNVESCPGNKPEALWIEERFNAHVARVRD
VELLTGLDFYQEKFQPVSEILQLKTYLPTFETII
Download sequence
Identical sequences ENSTTRP00000010785 ENSTTRP00000010785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]