SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010790 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010790
Domain Number 1 Region: 1212-1367,1406-1485
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.36e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1535-1732,1760-1785
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-39
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 763-910,944-991
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 127-272,360-429
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010790
Domain Number - Region: 1794-1839
Classification Level Classification E-value
Superfamily EF-hand 0.0181
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010790   Gene: ENSTTRG00000011378   Transcript: ENSTTRT00000011378
Sequence length 2004
Comment pep:novel genescaffold:turTru1:GeneScaffold_2935:405946:500445:-1 gene:ENSTTRG00000011378 transcript:ENSTTRT00000011378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTVLVPPGPDSFSFFTRESLAAIERRIAEEKAKNPKPDKKDDDERGPKPNSDLEAGKN
LPFIYGDIPPGMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCL
EDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCVWPPTNASLEEHSVEKNITVNYN
GTLVNETLVEFDWKSYVQDSRYHYFLEGFSDALLCGNSSDAGQCPEGYMCVKAGRNPNYG
YTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAV
VAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEAAQQAAAVTASVHSREPSAAGGLSD
SSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDDDEFHKSESEDSIRRKGFRFSIEGN
RLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDN
ESRRDSLFVPQRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVGGPSVPTSPV
GQLLPEVIDKPATDDKGTTTETDMRKRRSSSFHVSMDFLEDPSQRQRAMSIASILTNTVE
ELEESRQKCPPCWYKFSNMFLIWDCSPHWLKVKHIVNLVVMDPFVDLAITICIVLNTLFM
AMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIVTLSLV
ELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFA
VVGMQLFGKSYKDCVCKISSDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQ
AMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMHKGIAY
VKRKIYEFIQQSFIRKQKILDEIKPLDDLNNKKDSCMSNHTTEIGKDLDYLKDVNGTTSG
IGTGSSVEKYIIDESDYMSFIHNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKL
NESSSSSEGSTVDIGAPAEEQPVVEPEETLEPEACFTEGCVQRFKCCQISVEEGRGKQWW
NLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFTYIFIL
EMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRALRPLR
ALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTTGDMF
DISEVNNHSDCLILIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYAAVDSR
NVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQK
KYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQ
SEYVTSILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMFLAELI
EKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYA
IFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPNK
VNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDF
EMFYEVWEKFDPNATQFMEFEKLSQFAAALEPPLNLPQPNKVQLIAMDLPMVSGDRIHCL
DILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLRRKQEEVSAVIIQRA
YRRHLLKRTVKQASFTYNKNKIKGGANLLIKEDMVIDRINENSITEKTDLTMSTAACPPS
YDRVTKPIVEKHEQEGKDEKAKGK
Download sequence
Identical sequences ENSTTRP00000010790 ENSTTRP00000010790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]