SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010822 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010822
Domain Number 1 Region: 340-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000652
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 2 Region: 251-288
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000126
Family I set domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010822   Gene: ENSTTRG00000011409   Transcript: ENSTTRT00000011413
Sequence length 852
Comment pep:novel genescaffold:turTru1:GeneScaffold_1802:51137:157488:-1 gene:ENSTTRG00000011409 transcript:ENSTTRT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVCCSPLPRPPLXXXXXXXXXXXXXXSSERSSSSSGGESSSSWSSSNDSNSGISRSAA
PLEPRLSQQPQPRSLAARRAAARSRAAAAGGMRRDSALCFSMLLFGVSLACYSPSLKSVQ
DQAYKAPVVVEGKVQGLAPVGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVIS
VGSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCXXXXXXXX
XXXXXXXXXEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTTLSSWSGHARKCNETAKSYCVNGGVCYY
IEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQSFLSFLSKAEELYQKRVLTITGICV
ALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYI
SKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXTPARLSPVDFHYSLTTQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLRHPAPPG
PGPGPGTGADMQRSYDSYYYPAAGPGPRRGACALGGSLGSLPASPFRIPEDDEYETTQEC
APPPPPPRPRARGASRRTSAGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASD
DEADDADGALAAESTPFLGLRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRG
PPPRAKQDSGPL
Download sequence
Identical sequences ENSTTRP00000010822 ENSTTRP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]