SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010929 from Tursiops truncatus 69_1

(show help)
Strong hits

Sequence:	ENSTTRP00000010929
Domain Number 1	Region: 4-63
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	2.75e-24
Family	KRAB domain (Kruppel-associated box)	0.00083
Further Details:

Domain Number 2	Region: 232-289
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.77e-20
Family	Classic zinc finger, C2H2	0.0047
Further Details:

Domain Number 3	Region: 191-242
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.44e-17
Family	Classic zinc finger, C2H2	0.0071
Further Details:

Domain Number 4	Region: 131-180
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000179
Family	Classic zinc finger, C2H2	0.014
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSTTRP00000010929 Gene: ENSTTRG00000011523 Transcript: ENSTTRT00000011524
Sequence length	297
Comment	pep:novel scaffold:turTru1:scaffold_91697:5939:9729:1 gene:ENSTTRG00000011523 transcript:ENSTTRT00000011524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MEPLESVTFEDVAINFTQEEWALLDTSQKTLFRNVMLENITHLVSVGYQISKSDVISQLE QGKELWSEATGCLQGQSPDGESPLRLQEMIFTQSVYRKHIFATMPMQVSHTQRDPVGWTD LSDEFTPRSSPKHLSIHLRRKRNVSKQCGNSLSQGSFLDGQGHIHTRGKSCECPFCGKAF SNSSLRRKMIHTGEKPYKCHVCGKVFSQSSYKEHEKIHTGEKPYKCHLCEKTFNQISYLR KHKKIHSREKHYACHKCGKAFSQSSGLSQHKRIHTGEKPHICLLCGKAFSLLSDLRR
Download sequence
Identical sequences	ENSTTRP00000010929 ENSTTRP00000010929

SEARCH