SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011052 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011052
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-20
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 2 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 334-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000168
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011052
Domain Number - Region: 113-139
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0366
Family KRAB domain (Kruppel-associated box) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011052   Gene: ENSTTRG00000011655   Transcript: ENSTTRT00000011654
Sequence length 396
Comment pep:novel scaffold:turTru1:scaffold_89945:87189:97851:1 gene:ENSTTRG00000011655 transcript:ENSTTRT00000011654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAAKVVPIPLKPKRSFILRVPPNSKLGQDLLRDATSGPKTIHQLVLEHFLTFLPKPSLV
QPSQKVKETLVIVKDVSSNLQNRVQPHPLVKLLPREGIQQKQETVSLCLKAESEELVVFE
DLNVFHSQEECVSLDPVQQPTSEIQDNSIGEMMLLAVSDSNPEGEDLQKEPVENEEQREK
SSDCDEIDCSVVSEQPPDCQKEEGLNTCIPKERKMRNLLVTIENDTPLEELSKYVDISVI
ALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPYDCSHCGKSFNHKTNLNKHER
IHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPGNKEFVIHLQSHEA
ERPYGCTKCGRRFGRLSNCTRHEKTHSACKIRKQKW
Download sequence
Identical sequences ENSTTRP00000011052 ENSTTRP00000011052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]