SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011197 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011197
Domain Number 1 Region: 544-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 600-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.23e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 445-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 6 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000199
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 7 Region: 271-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000154
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 406-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000064
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011197
Domain Number - Region: 314-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.063
Family Classic zinc finger, C2H2 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011197   Gene: ENSTTRG00000011818   Transcript: ENSTTRT00000011807
Sequence length 668
Comment pep:novel genescaffold:turTru1:GeneScaffold_2183:5139:13793:1 gene:ENSTTRG00000011818 transcript:ENSTTRT00000011807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFQEPVSFKDVAVTFTKEELGLLDSTQRKLYQDVMLENFRNLVSVGYLPFKLDMILQL
GRKKKLWVMEPEAQGAGCSGHGNQNEIETLQEAGLRQLLHEGLMCWQIWEQFTSKLTRTQ
DSIINLQGKKLPKQDDSSCEAWSGESTQLPEDENYVGKLQGESSTSIKNQVSPTQTSWDF
WRKMYLRESQNYQSRCQQIDIKDKLCQCDHCVMRRISHHHGNQEVHKSEKACGHNNHGKD
FVKNTSQHSIIHSGEQTSDETGKGVSLGYDVELHQQLRVGEKPHVCSECGKGSTYNSVFH
IHYSVHRGGKRSGNDECGVDLGQSSHPETHQRVNPGEKPYRSGVCAAESFNQNSSLPTHE
PIHPGENLCRGGRCGKGSSHILDLNSHCVENTGEKSWKCELCGKGFNETSQIQAHQTAYP
QDKTSKWKAYDRIFSQSSGPLQRVHTGGKPYKCDVCGKDFSKASNLQAHQRIHTGEKPYQ
CDVCNKSFSRNSHLQAHQRVHTGEKPYRCDTCGKDFSQISHLQAHQRVHTGEKPYRCDIC
GKGFSQSSHLQDHQRVHTGEKPYTCDVCGKGFSWSSHLQAHQRVHTGEKPYKCEECGKGF
IWNSYLHVHQRIHTGEKPYKCGMCGKSFSQTSHLQAHQRVHTGEKPYKCFDCGKGFSKSS
SSGSSESP
Download sequence
Identical sequences ENSTTRP00000011197 ENSTTRP00000011197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]