SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011356 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011356
Domain Number 1 Region: 1558-1808
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-33
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 96-243,288-366
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-33
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 1236-1358,1432-1509
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.33e-17
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 4 Region: 486-717
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.16e-17
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011356   Gene: ENSTTRG00000011945   Transcript: ENSTTRT00000011974
Sequence length 2393
Comment pep:novel genescaffold:turTru1:GeneScaffold_1645:12735:251462:-1 gene:ENSTTRG00000011945 transcript:ENSTTRT00000011974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAQKMYKPIMAQRARTMA
LYNPIPVRQNCVTVNRSLFLSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALEQHL
PDDDKTPMSERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGI
LATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIFA
IIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQF
DNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSG
EFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGAL
RRATIKKSKTDLLNPEEAEDPLADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIR
RMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGL
GTRPYFHSSFNCFDCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYWASLR
NLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTV
FQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQ
ELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKTHLDRPLVDPQERNNNNKSRAAEP
TVDQRLGQQRAEDFRKQARYHDRARDPCGSVGLDTRRPWAGSQEAELSREGPYGRESDHH
AREGGLEQPGFWEGEAERGKVCDPHRRHAHRQGCSRESRSGSPRTGADGEPRRHRAHRRP
GDEGPEDKADRRSRHREGSRPARGGEGEGPDGGERRRRHRLGPPPAYDGDARREDKERRH
RRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESASPHDSLG
HAGLPQSPAKMANSTDPSPAPAPPATAANPQNASSRRTPNNPGNPSNPGPPKTPENSLIV
TNPSSTQTTSAKTARKPDHTTVDIPPACPRPLNHTVVQVNKNANPDPLPKKEEEKKEEEE
DDPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPV
QPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVA
FAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKYLLYEKNEVKARDREWKKYEFHYDNVL
WALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFV
ALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPP
FEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGILNYFR
DAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQ
SFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALM
LLFRSATGEAWHNIMLSCLSGKPCDKNSGILTHECGNEFAYFYFVSFIFLCSFLMLNLFV
AVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHYKDMYSLLRVISPPLGLGK
KCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEM
MAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQNRTPLM
FQRMEPPSPTQEGAPGQNALPSTQLDPGGGLMAHESGMKESPSWVTQRAQEMFQKTGTWS
PERGPPTDMPNSQPNSQSVEMREMGRDGYSDSEHYLPMEGQARATSMPRLPAENQXXXXX
XXXXXXXTISDTSPMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRSHRASERS
LGRYTDVDTGLGTDLSMTTQSGDLPSKERDQYRGRPKDRKPRLHRHHHHHHHPPPPDKER
YAQERPDHGRTRARDQRWSRSPSEGREHMAHRQGSSSVSGSPAPSTSGTSTPRRGRRQLP
QTPSTPRPHVSYSPVIRKAGGSGPPQQQQQQQQPAVRPSRAAPSGPRRYPGSSSEPLAGE
RPPTWDHGSSRSPTMERRVPGMARSESTRVCRHGGERWPASGAHAVKRPPVPR
Download sequence
Identical sequences ENSTTRP00000011356 ENSTTRP00000011356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]