SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011644 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011644
Domain Number 1 Region: 543-776
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.59e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1226-1486
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.96e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 905-1060,1100-1178
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 127-296,374-414
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.33e-26
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011644   Gene: ENSTTRG00000012271   Transcript: ENSTTRT00000012275
Sequence length 2182
Comment pep:novel genescaffold:turTru1:GeneScaffold_2121:79712:399103:1 gene:ENSTTRG00000012271 transcript:ENSTTRT00000012275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMMMMMKKMQHQRQQQADHANXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEESKRNTSMPTSETESVNTENVS
GEGENQGCCGSLWCWWRRRGTTKAGPSGCRRWGQAISKSKLSRRWRRWNRFSRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEINQIANSDNKVTIDDYREEDEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRMSELNMKEKITPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDNPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
IYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIVDVALSEADPTESENVPVP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPAVLLLFRCATGEAWQEIMLACLPGKLC
DPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
LDEFKRIWSEYDPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLVAMNMPLNSD
GTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEV
TVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKSSTIALQAGLRTLHDIGPEIRRAISCD
LQDDEPEETKGEEEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPA
SDTEKPLFPPAGNSVCHNHHNHNSIGKQVPSSTNANLNNANMSKAAPGKRPSIGNLEHVS
ENGHHSFHKHGREPQRRCSIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXQSYSCGYYTRYPGSSLDFERPRGYHHPQSFSEDDDSPVC
YDSRRSPRRRLLPPTPTSPRRSSFNFECLRRHSSQEEFLPSPAFPHRTALPLHLMQQQIM
AVAGLDSSKAQKYSPSHSTRSWATPPATPSYRDWTPCYTPLIQVERSEAPDQVNGSLPSL
HRSSWYTDEPGVSYRTFTPASLTVPSSFHNKNSDKQRSADSLVEAVLISEGLGRYARDPK
FVSATKHEIADACDLTIDEMESAASNLLNGNMHPRANGDVGPVSRRQDYELQDFGPGYSD
EEPDLGRDEEDLADEMICITTL
Download sequence
Identical sequences ENSTTRP00000011644 ENSTTRP00000011644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]