SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011701 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011701
Domain Number 1 Region: 69-98,148-208
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-24
Family Voltage-gated potassium channels 0.0042
Further Details:      
 
Domain Number 2 Region: 294-365
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000133
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011701   Gene: ENSTTRG00000012335   Transcript: ENSTTRT00000012334
Sequence length 538
Comment pep:novel genescaffold:turTru1:GeneScaffold_503:68536:157286:-1 gene:ENSTTRG00000012335 transcript:ENSTTRT00000012334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGAFKRGRTGGCPSNSVAVPAAAPPVCQPKGTTNGHYAAPRLSISSRATVVARMEGASQ
GALQTVMKCKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIAMEKAEFLRDHVCVS
PQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGG
KIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNAGINYREWYKPLV
WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSV
EIHDKLQRAATLRSMERRRLGLDQRAHSLDMLSPEKRSVFAALDAGRFKASSQDSINNRP
NNLRLQGSEQLNKHGQGASEDNIINKFGSASRLTKRKNKDIRKTLPEDVQKIYRTFRNYS
LDEEKREEAAEKVCNPDHSSTAVLTDCIQPQAEMENGVAPTDTKDQERENNALLEGRN
Download sequence
Identical sequences ENSTTRP00000011701 ENSTTRP00000011701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]